HPA001758

SOX9 antibody from Sigma-Aldrich
CMD1, CMPD1, SRA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001758
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001758, RRID:AB_1080067
Product name
Anti-SOX9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001758
Antibody type
Polyclonal
Antigen
Transcription factor SOX-9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLP
HYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTG
LYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQ
HWEQPVYTQLTR
Storage
-20C
Provider Type Product Number
- No reagents -