H00027141-M12

CIDEB antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00027141-M12
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027141-M12, RRID:AB_1237674
Product name
CIDEB monoclonal antibody (M12), clone 3H4
Provider product page
Abnova Corporation - H00027141-M12
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CIDEB.
Antigen sequence
MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQ
RPFRVCDHKRTIRKGLTAATRQELLAKALETLLLN
GVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSG
QSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYK
QNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVL
RELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQW
QQKGRLHSY
Isotype
IgG
Antibody clone number
3H4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -