HPA019937

KASH5 antibody from Atlas Antibodies

CCDC155, FLJ32658

Immunohistochemistry: Supportive data in Antibodypedia

Provider product page for HPA019937

Antibody data

Submit

Validation data

Product number: HPA019937
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA019937, RRID:AB_1848877
Product name: Anti-CCDC155
Provider product page: Atlas Antibodies - HPA019937
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EENGKLLAERDGVKKRSQELAMEKDTLKRQLFECE HLICQRDTILSERTRDVESLAQTLEEYRVTTQELR LEISRLEEQLSQTYEGPDELPEGA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows distinct cytoplasmic positivity in neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CCDC155 antibody HPA019937.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CCDC155 antibody HPA019937.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CCDC155 antibody HPA019937.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CCDC155 antibody HPA019937.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-CCDC155 antibody HPA019937 (A) shows similar protein distribution across tissues to independent antibody HPA019940 (B).
Antibody #2 product nr: HPA019940
Antibody provider: Atlas Antibodies

: Show more