Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004212-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004212-M01, RRID:AB_425545
- Product name
- MEIS2 monoclonal antibody (M01), clone 1H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant MEIS2.
- Antigen sequence
MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHAT
QHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGH
PLFPLLALVFEKCELATCTPREPGVAGGDVCSSDS
FNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQV
LRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLV
IDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDD
ATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNS
VASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRA
WLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFI
NARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFV
LDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM- Isotype
- IgG
- Antibody clone number
- 1H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Structure of the DDB1-CRBN E3 ubiquitin ligase in complex with thalidomide.
Cooperative transcriptional activation by Klf4, Meis2, and Pbx1.
A neuronal migratory pathway crossing from diencephalon to telencephalon populates amygdala nuclei.
Fischer ES, Böhm K, Lydeard JR, Yang H, Stadler MB, Cavadini S, Nagel J, Serluca F, Acker V, Lingaraju GM, Tichkule RB, Schebesta M, Forrester WC, Schirle M, Hassiepen U, Ottl J, Hild M, Beckwith RE, Harper JW, Jenkins JL, Thomä NH
Nature 2014 Aug 7;512(7512):49-53
Nature 2014 Aug 7;512(7512):49-53
Cooperative transcriptional activation by Klf4, Meis2, and Pbx1.
Bjerke GA, Hyman-Walsh C, Wotton D
Molecular and cellular biology 2011 Sep;31(18):3723-33
Molecular and cellular biology 2011 Sep;31(18):3723-33
A neuronal migratory pathway crossing from diencephalon to telencephalon populates amygdala nuclei.
García-Moreno F, Pedraza M, Di Giovannantonio LG, Di Salvio M, López-Mascaraque L, Simeone A, De Carlos JA
Nature neuroscience 2010 Jun;13(6):680-9
Nature neuroscience 2010 Jun;13(6):680-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MEIS2 monoclonal antibody (M01), clone 1H4 Western Blot analysis of MEIS2 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MEIS2 monoclonal antibody (M01), clone 1H4. Western Blot analysis of MEIS2 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MEIS2 expression in transfected 293T cell line by MEIS2 monoclonal antibody (M01), clone 1H4.Lane 1: MEIS2 transfected lysate(51.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MEIS2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MEIS2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MEIS2 on formalin-fixed paraffin-embedded human spleen tissue. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol