HPA008147

ATP6V1B2 antibody from Sigma-Aldrich
ATP6B2, HO57, VATB, Vma2, VPP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008147
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008147, RRID:AB_1845195
Product name
Anti-ATP6V1B2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008147
Antibody type
Polyclonal
Antigen
V-type proton ATPase subunit B, brain isoform recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAV
SRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAE
IVHLTLPDGTKRSGQVLEVSGSKAVVQVFE
Storage
-20C
Provider Type Product Number
- No reagents -