Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002551-M06 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002551-M06, RRID:AB_733167
- Product name
- GABPA monoclonal antibody (M06), clone 5B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GABPA.
- Antigen sequence
MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPA
ECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICL
QDIQLDPERSLFDQGVKTDGTVQLSVQVIS- Isotype
- IgG
- Antibody clone number
- 5B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of GABPA expression in transfected 293T cell line by GABPA monoclonal antibody (M06), clone 5B6.Lane 1: GABPA transfected lysate (Predicted MW: 51.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to GABPA on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to GABPA on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol