HPA003258

GABPA antibody from Atlas Antibodies
E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003258
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003258, RRID:AB_1078928
Product name
Anti-GABPA
Provider product page
Atlas Antibodies - HPA003258
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EELIEIEIDGTEKAECTEESIVEQTYAPAECVSQA
IDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLD
PERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNIL
EIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITL
DGTK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -