HPA003258

GABPA antibody from Sigma-Aldrich
E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003258
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003258, RRID:AB_1078928
Product name
Anti-GABPA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003258
Antibody type
Polyclonal
Antigen
GA-binding protein alpha-chain recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EELIEIEIDGTEKAECTEESIVEQTYAPAECVSQA
IDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLD
PERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNIL
EIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITL
DGTK
Storage
-20C
Provider Type Product Number
- No reagents -