HPA024335

OTOR antibody from Atlas Antibodies
FDP, MIAL, MIAL1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024335
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024335, RRID:AB_1854838
Product name
Anti-OTOR
Provider product page
Atlas Antibodies - HPA024335
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLASKKLCADDECVYTISLASAQEDYNAPDCRFIN
VKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEM
GVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -