Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003175 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-BACH1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIE
ESCFQFLKFKFLDSTADQQECPRKKCFSSHCQKTD
LKLSLLDQRDLETDEVEEFLENKNVQTPQCKLRRY
QGNAKASPPLQDSASQTYESMCLEKDAALA- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Network of mutually repressive metastasis regulators can promote cell heterogeneity and metastatic transitions
Transcriptional Network Analysis Identifies BACH1 as a Master Regulator of Breast Cancer Bone Metastasis
Antibody-based Protein Profiling of the Human Chromosome 21
Lee J, Lee J, Farquhar K, Yun J, Frankenberger C, Bevilacqua E, Yeung K, Kim E, Balázsi G, Rosner M
Proceedings of the National Academy of Sciences 2014;111(3)
Proceedings of the National Academy of Sciences 2014;111(3)
Transcriptional Network Analysis Identifies BACH1 as a Master Regulator of Breast Cancer Bone Metastasis
Liang Y, Wu H, Lei R, Chong R, Wei Y, Lu X, Tagkopoulos I, Kung S, Yang Q, Hu G, Kang Y
Journal of Biological Chemistry 2012;287(40):33533-33544
Journal of Biological Chemistry 2012;287(40):33533-33544
Antibody-based Protein Profiling of the Human Chromosome 21
Uhlén M, Oksvold P, Älgenäs C, Hamsten C, Fagerberg L, Klevebring D, Lundberg E, Odeberg J, Pontén F, Kondo T, Sivertsson Å
Molecular & Cellular Proteomics 2012;11(3):M111.013458
Molecular & Cellular Proteomics 2012;11(3):M111.013458
No comments: Submit comment
No validations: Submit validation data