HPA003175

BACH1 antibody from Sigma-Aldrich
BACH-1, BTBD24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003175
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003175, RRID:AB_1078262
Product name
Anti-BACH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003175
Antibody type
Polyclonal
Antigen
Transcription regulator protein BACH1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIE
ESCFQFLKFKFLDSTADQQECPRKKCFSSHCQKTD
LKLSLLDQRDLETDEVEEFLENKNVQTPQCKLRRY
QGNAKASPPLQDSASQTYESMCLEKDAALA
Storage
-20C
Provider Type Product Number
- No reagents -