Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002295-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002295-M04, RRID:AB_581575
- Product name
- FOXF2 monoclonal antibody (M04), clone 2G10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FOXF2.
- Antigen sequence
SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSY
LHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNG
ISSFHPSASGSYYHHHHQSVCQDIKPCV- Isotype
- IgG
- Antibody clone number
- 2G10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references MicroRNA-301 mediates proliferation and invasion in human breast cancer.
Shi W, Gerster K, Alajez NM, Tsang J, Waldron L, Pintilie M, Hui AB, Sykes J, P'ng C, Miller N, McCready D, Fyles A, Liu FF
Cancer research 2011 Apr 15;71(8):2926-37
Cancer research 2011 Apr 15;71(8):2926-37
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FOXF2 monoclonal antibody (M04), clone 2G10. Western Blot analysis of FOXF2 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FOXF2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to FOXF2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol