Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108246 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Mesoderm Induction Early Response 1 Homolog (Xenopus Laevis) (MIER1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MIER1 antibody: synthetic peptide directed towards the middle region of human MIER1
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
RRTGDEKGVEAIPEGSHIKDNEQALYELVKCNFDT
EEALRRLRF- Epitope
- Middle Region
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Molecular cloning of human er1 cDNA and its differential expression in breast tumours and tumour-derived cell lines.
Paterno GD, Mercer FC, Chayter JJ, Yang X, Robb JD, Gillespie LL
Gene 1998 Nov 5;222(1):77-82
Gene 1998 Nov 5;222(1):77-82
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Jurkat; WB Suggested Anti-MIER1 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate; MIER1 antibody - middle region (AP42299PU-N) in Human Jurkat cells using Western Blot