HPA021536

LRCH1 antibody from Sigma-Aldrich
CHDC1, KIAA1016
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021536
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021536, RRID:AB_1853258
Product name
Anti-LRCH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021536
Antibody type
Polyclonal
Antigen
Leucine-rich repeat and calponin homology domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDT
VSLNVPMSNIMEEEQIIKEDSCHRLSPVKGEFHQE
FQPEPSLLGDSTNSGEERDQFTDRADGLHSEFMNY
KATTAEDC
Storage
-20C
Provider Type Product Number
- No reagents -