HPA015654

BSX antibody from Sigma-Aldrich
BSX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015654
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015654, RRID:AB_1845470
Product name
Anti-BSX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015654
Antibody type
Polyclonal
Antigen
Brain-specific homeobox protein homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NFTSPLHPASSQRPTSFFIEDILLHKPKPLREVAP
DHFASSLASRVPLLDYGYPLMPTPTLLAPHAHHPL
HKGDHHHPYFLTTSGMPVPALFPHPQHAELPGKHC
RRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVEL
A
Storage
-20C
Provider Type Product Number
- No reagents -