HPA003278

NEUROD1 antibody from Sigma-Aldrich
BETA2, BHF-1, bHLHa3, MODY6, NEUROD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003278
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003278, RRID:AB_1845331
Product name
Anti-NEUROD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003278
Antibody type
Polyclonal
Antigen
Neurogenic differentiation factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPP
HAYSAALEPFFESPLTDCTSPSFDGPLSPPLSING
NFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGS
IFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL
Storage
-20C
Provider Type Product Number
- No reagents -