HPA024450

ZBTB49 antibody from Atlas Antibodies
FLJ38559, ZNF509
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024450
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024450, RRID:AB_1859311
Product name
Anti-ZBTB49
Provider product page
Atlas Antibodies - HPA024450
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AFSQYFRSLFQNSSSQKNDVFHLDVKNVSGIGQIL
DFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCH
TFLKSATVVQPPGMPCNSTLSLQSTLTPDATCVIS
ENYP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -