Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024450 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024450, RRID:AB_1859311
- Product name
- Anti-ZBTB49
- Antibody type
- Polyclonal
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AFSQYFRSLFQNSSSQKNDVFHLDVKNVSGIGQIL
DFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCH
TFLKSATVVQPPGMPCNSTLSLQSTLTPDATCVIS
ENYP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Tissue-Specific Protein Expression in Human Cells, Tissues and Organs
Per Oksvold M
Journal of Proteomics & Bioinformatics 2010 ;03(10)
Journal of Proteomics & Bioinformatics 2010 ;03(10)
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.
- Sample type
- HUMAN