HPA024450

ZBTB49 antibody from Sigma-Aldrich
FLJ38559, ZNF509
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024450
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024450, RRID:AB_1859311
Product name
Anti-ZNF509 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024450
Antibody type
Polyclonal
Antigen
Zinc finger protein 509 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AFSQYFRSLFQNSSSQKNDVFHLDVKNVSGIGQIL
DFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCH
TFLKSATVVQPPGMPCNSTLSLQSTLTPDATCVIS
ENYP
Storage
-20C
Provider Type Product Number
- No reagents -