Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003259 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003259, RRID:AB_1079381
- Product name
- Anti-MITF
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRI
IKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTIT
FNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLS
PVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references MITF and c-Jun antagonism interconnects melanoma dedifferentiation with pro-inflammatory cytokine responsiveness and myeloid cell recruitment.
Enhancer-targeted genome editing selectively blocks innate resistance to oncokinase inhibition.
Riesenberg S, Groetchen A, Siddaway R, Bald T, Reinhardt J, Smorra D, Kohlmeyer J, Renn M, Phung B, Aymans P, Schmidt T, Hornung V, Davidson I, Goding CR, Jönsson G, Landsberg J, Tüting T, Hölzel M
Nature communications 2015 Nov 4;6:8755
Nature communications 2015 Nov 4;6:8755
Enhancer-targeted genome editing selectively blocks innate resistance to oncokinase inhibition.
Webster DE, Barajas B, Bussat RT, Yan KJ, Neela PH, Flockhart RJ, Kovalski J, Zehnder A, Khavari PA
Genome research 2014 May;24(5):751-60
Genome research 2014 May;24(5):751-60
No comments: Submit comment
Enhanced validation
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-MITF antibody. Corresponding MITF RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and MITF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404987).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in melanocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human melanoma shows strong nuclear positivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows moderate nuclear positivity in cells in endometrial stroma.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows no positivity as expected.
- Sample type
- HUMAN