Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004087-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004087-M05, RRID:AB_581885
- Product name
- SMAD2 monoclonal antibody (M05), clone 3G9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SMAD2.
- Antigen sequence
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSN
YIPETPPPGYISEDGETSDQQLNQSMDTGSPAELS
PTTLSPVNHSLDLQPVTYSEPAFWCSIAYY- Isotype
- IgG
- Antibody clone number
- 3G9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Altered expression of p120catenin predicts poor outcome in invasive breast cancer.
Talvinen K, Tuikkala J, Nykänen M, Nieminen A, Anttinen J, Nevalainen OS, Hurme S, Kuopio T, Kronqvist P
Journal of cancer research and clinical oncology 2010 Sep;136(9):1377-87
Journal of cancer research and clinical oncology 2010 Sep;136(9):1377-87
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SMAD2 monoclonal antibody (M05), clone 3G9 Western Blot analysis of SMAD2 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SMAD2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SMAD2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SMAD2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol