H00004087-M17

SMAD2 antibody from Abnova Corporation
JV18-1, MADH2, MADR2

Antibody data

Product number
H00004087-M17
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004087-M17, RRID:AB_1204990
Product name
SMAD2 monoclonal antibody (M17), clone 4D4
Provider product page
Abnova Corporation - H00004087-M17
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SMAD2.
Antigen sequence
LGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVK
KLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIW
GLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSH
Isotype
IgG
Antibody clone number
4D4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -