Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003316 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003316, RRID:AB_1078757
- Product name
- Anti-ELF3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHS
SDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGK
RKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFI
RDILIHP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Overexpression of ELF3 in the PTEN-deficient lung epithelium promotes lung cancer development by inhibiting ferroptosis
LncRNA ELF3-AS1 inhibits gastric cancer by forming a negative feedback loop with SNAI2 and regulates ELF3 mRNA stability via interacting with ILF2/ILF3 complex
Yuan Z, Han X, Xiao M, Zhu T, Xu Y, Tang Q, Lian C, Wang Z, Li J, Wang B, Li C, Xiang X, Jin R, Liu Y, Yu X, Zhang K, Li S, Ray M, Li R, Gruzdev A, Shao S, Shao F, Wang H, Lian W, Tang Y, Chen D, Lei Y, Jin X, Li Q, Long W, Huang H, DeMayo F, Liu J
Cell Death & Disease 2024;15(12)
Cell Death & Disease 2024;15(12)
LncRNA ELF3-AS1 inhibits gastric cancer by forming a negative feedback loop with SNAI2 and regulates ELF3 mRNA stability via interacting with ILF2/ILF3 complex
Li D, Shen L, Zhang X, Chen Z, Huang P, Huang C, Qin S
Journal of Experimental & Clinical Cancer Research 2022;41(1)
Journal of Experimental & Clinical Cancer Research 2022;41(1)
No comments: Submit comment
No validations: Submit validation data