HPA003479

ELF3 antibody from Atlas Antibodies
EPR-1, ERT, ESE-1, ESX
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003479
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003479, RRID:AB_1078756
Product name
Anti-ELF3
Provider product page
Atlas Antibodies - HPA003479
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGA
DDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQV
LDWISYQVEKNKYDASAIDFSRCDMDGATLCNCAL
EELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIEL
LEKDGMA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -