HPA003479

ELF3 antibody from Sigma-Aldrich
EPR-1, ERT, ESE-1, ESX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003479
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003479, RRID:AB_1078756
Product name
Anti-ELF3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003479
Antibody type
Polyclonal
Antigen
E74-like factor 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGA
DDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQV
LDWISYQVEKNKYDASAIDFSRCDMDGATLCNCAL
EELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIEL
LEKDGMA
Storage
-20C
Provider Type Product Number
- No reagents -