Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054101-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054101-M01, RRID:AB_464391
- Product name
- RIPK4 monoclonal antibody (M01), clone 2G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RIPK4.
- Antigen sequence
HLAARNGHLATVKLLVEEKADVLARGPLNQTALHL
AAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQ
GRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLL
RRSKT- Isotype
- IgG
- Antibody clone number
- 2G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references RIP4 is a target of multiple signal transduction pathways in keratinocytes: implications for epidermal differentiation and cutaneous wound repair.
Adams S, Munz B
Experimental cell research 2010 Jan 1;316(1):126-37
Experimental cell research 2010 Jan 1;316(1):126-37
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RIPK4 monoclonal antibody (M01), clone 2G3 Western Blot analysis of RIPK4 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RIPK4 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol