HPA015816

ZMYND11 antibody from Sigma-Aldrich
BS69
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015816
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015816, RRID:AB_1845427
Product name
Anti-ZMYND11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015816
Antibody type
Polyclonal
Antigen
Zinc finger MYND domain-containing protein 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AWIPSENIQDITVNIHRLHVKRSMGWKKACDELEL
HQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQL
KVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSSSQ
EIPTMP
Storage
-20C
Provider Type Product Number
- No reagents -