HPA024290

DMTN antibody from Atlas Antibodies
DMT, EPB49
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024290
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024290, RRID:AB_1847601
Product name
Anti-DMTN
Provider product page
Atlas Antibodies - HPA024290
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SKSSSLPAYGRTTLSRLQSTEFSPSGSETGSPGLQ
NGEGQRGRMDRGNSLPCVLEQKIYPYEMLVVTNKG
RTKLPP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -