Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503641 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Rhabdoid Tumor Deletion Region Gene 1 (RTDR1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RTDR1 antibody: synthetic peptide directed towards the middle region of human RTDR1
- Description
- Affinity Purified
- Reactivity
- Human, Bovine
- Host
- Rabbit
- Antigen sequence
IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEV
ETYEK PQVAEALQRA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references High-throughput mapping of a dynamic signaling network in mammalian cells.
Barrios-Rodiles M, Brown KR, Ozdamar B, Bose R, Liu Z, Donovan RS, Shinjo F, Liu Y, Dembowy J, Taylor IW, Luga V, Przulj N, Robinson M, Suzuki H, Hayashizaki Y, Jurisica I, Wrana JL
Science (New York, N.Y.) 2005 Mar 11;307(5715):1621-5
Science (New York, N.Y.) 2005 Mar 11;307(5715):1621-5
No comments: Submit comment
No validations: Submit validation data