HPA016865

CTIF antibody from Sigma-Aldrich
KIAA0427
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016865
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016865, RRID:AB_1852311
Product name
Anti-KIAA0427 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016865
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA0427 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLP
HIDREGCGKGKLEDGDGINLNDIEKVLPAWQGYHP
MPHEVEIAHTKKLFR
Storage
-20C
Provider Type Product Number
- No reagents -