HPA024801

CTIF antibody from MilliporeSigma / Merck KGaA
KIAA0427
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024801
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA024801, RRID:AB_1852312
Product name
Anti-KIAA0427 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA024801
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA0427 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGFITFLCEVFGTMRSSTGEPFRVLVCPIYTCLRE
LLQSQDVKEDAVLCCSMELQSTGRLLEEQLPEMMT
ELLASARDKMLCPSESMLTRSLLLEVIELHANSWN
PLTPPITQYYNRTIQKLTA
Storage
-20C
Provider Type Product Number
- No reagents -