HPA016865

CTIF antibody from Atlas Antibodies
KIAA0427
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016865
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016865, RRID:AB_1852311
Product name
Anti-CTIF
Provider product page
Atlas Antibodies - HPA016865
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLP
HIDREGCGKGKLEDGDGINLNDIEKVLPAWQGYHP
MPHEVEIAHTKKLFR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -