Antibody data

Product number
H00001992-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001992-M02, RRID:AB_1204963
Product name
SERPINB1 monoclonal antibody (M02), clone 4D7
Provider product page
Abnova Corporation - H00001992-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SERPINB1.
Antigen sequence
KKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDD
IEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVN
VSLPRFKLEESYTLNSDLARLGVQDLFNSS
Isotype
IgG
Antibody clone number
4D7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -