HPA018871

SERPINB1 antibody from Sigma-Aldrich
anti-elastase, EI, ELANH2, PI2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018871
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018871, RRID:AB_1856724
Product name
Anti-SERPINB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018871
Antibody type
Polyclonal
Antigen
Leukocyte elastase inhibitor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKK
FAYGYIEDLKCRVLELPYQGEELSMVILLPDDIED
ESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSL
PRFK
Storage
-20C
Provider Type Product Number
- No reagents -