Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [9]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018871 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA018871, RRID:AB_1856724
- Product name
- Anti-SERPINB1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKK
FAYGYIEDLKCRVLELPYQGEELSMVILLPDDIED
ESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSL
PRFK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Proteomic analysis reveals heat shock protein 70 has a key role in polycythemia Vera.
Gallardo M, Barrio S, Fernandez M, Paradela A, Arenas A, Toldos O, Ayala R, Albizua E, Jimenez A, Redondo S, Garcia-Martin RM, Gilsanz F, Albar JP, Martinez-Lopez J
Molecular cancer 2013 Nov 19;12:142
Molecular cancer 2013 Nov 19;12:142
No comments: Submit comment
Enhanced validation
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines SK-MEL-30 and U-251MG using Anti-SERPINB1 antibody. Corresponding SERPINB1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-SERPINB1 antibody HPA018871 (A) shows similar pattern to independent antibody HPA052642 (B).
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human esophagus and cerebral cortex tissues using Anti-SERPINB1 antibody. Corresponding SERPINB1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow, kidney, liver and testis using Anti-SERPINB1 antibody HPA018871 (A) shows similar protein distribution across tissues to independent antibody HPA052642 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human esophagus shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-SERPINB1 antibody HPA018871.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-SERPINB1 antibody HPA018871.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-SERPINB1 antibody HPA018871.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow using Anti-SERPINB1 antibody HPA018871.
- Sample type
- HUMAN