HPA025040

FAM160B2 antibody from Atlas Antibodies
FLJ21801, RAI16
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025040
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025040, RRID:AB_1856049
Product name
Anti-FAM160B2
Provider product page
Atlas Antibodies - HPA025040
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IIHSLVLRNLEGRPYVAWGSPEPESYEDTLDLEED
PYFTDSFLDSGFQTPAKPRLAPATSYDGKTAVTEI
VNSFLCLVPEEAKTSA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -