HPA025040

FAM160B2 antibody from Sigma-Aldrich
FLJ21801, RAI16
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025040
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025040, RRID:AB_1856049
Product name
Anti-FAM160B2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025040
Antibody type
Polyclonal
Antigen
UPF0518 protein FAM160B2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IIHSLVLRNLEGRPYVAWGSPEPESYEDTLDLEED
PYFTDSFLDSGFQTPAKPRLAPATSYDGKTAVTEI
VNSFLCLVPEEAKTSA
Storage
-20C
Provider Type Product Number
- No reagents -