HPA003357

SP2 antibody from Atlas Antibodies
KIAA0048
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003357
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003357, RRID:AB_1080070
Product name
Anti-SP2
Provider product page
Atlas Antibodies - HPA003357
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLVPIKPAPLPLSPGKNSFGILSSKGNILQIQGSQ
LSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAV
PQIQASNSQTIQVQPNLTNQIQIIPGTNQAIITPS
PSSHKPVPIKPAPIQKSST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -