HPA003357

SP2 antibody from Sigma-Aldrich
KIAA0048
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003357
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003357, RRID:AB_1080070
Product name
Anti-SP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003357
Antibody type
Polyclonal
Antigen
Transcription factor Sp2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLVPIKPAPLPLSPGKNSFGILSSKGNILQIQGSQ
LSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAV
PQIQASNSQTIQVQPNLTNQIQIIPGTNQAIITPS
PSSHKPVPIKPAPIQKSST
Storage
-20C
Provider Type Product Number
- No reagents -