HPA058536

STK32B antibody from Atlas Antibodies
HSA250839, STK32, STKG6, YANK2

Antibody data

Product number
HPA058536
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA058536, RRID:AB_2683746
Product name
Anti-STK32B
Provider product page
Atlas Antibodies - HPA058536
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFK
KALMPGFV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -