HPA015820

STK32B antibody from Sigma-Aldrich
HSA250839, STK32, STKG6, YANK2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015820
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015820, RRID:AB_1858913
Product name
Anti-STK32B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015820
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase 32B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KKKRLAKNRSRDGTKDSCPLNGHLQHCLETVREEF
IIFNREKLRRQQGQGSQLLDTDSRGGGQAQSKLQD
GCNNNLLTHTCTRGC
Storage
-20C
Provider Type Product Number
- No reagents -