HPA015820

STK32B antibody from Atlas Antibodies
HSA250839, STK32, STKG6, YANK2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015820
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015820, RRID:AB_1236171
Product name
Anti-STK32B
Provider product page
Atlas Antibodies - HPA015820
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KKKRLAKNRSRDGTKDSCPLNGHLQHCLETVREEF
IIFNREKLRRQQGQGSQLLDTDSRGGGQAQSKLQD
GCNNNLLTHTCTRGC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -