HPA003358

ZNF146 antibody from Sigma-Aldrich
OZF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003358
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003358, RRID:AB_1080674
Product name
Anti-ZNF146 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003358
Antibody type
Polyclonal
Antigen
Zinc finger protein OZF recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSQQRIYSGENPFACKVCGKVFSHKSNLTEHEHFH
TREKPFECNECGKAFSQKQYVIKHQNTHTGEKLFE
CNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKA
FIQKSNLIR
Storage
-20C
Provider Type Product Number
- No reagents -