HPA001423

PACS2 antibody from Atlas Antibodies
KIAA0602, PACS1L
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001423
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001423, RRID:AB_2156757
Product name
Anti-PACS2
Provider product page
Atlas Antibodies - HPA001423
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LAWRDLFNKLEAQSAVQDTPDIVSRITQYIAGANC
AHQLPIAEAMLTYKQKSPDEESSQKFIPFVGVVKV
GIVEPSSATSGDSDDAAPSGSGTLSSTPPSASPAA
KEASPTPPSSPSVSGG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -