HPA001423

PACS2 antibody from Sigma-Aldrich
KIAA0602, PACS1L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001423
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001423, RRID:AB_2156757
Product name
Anti-PACS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001423
Antibody type
Polyclonal
Antigen
Phosphofurin acidic cluster sorting protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LAWRDLFNKLEAQSAVQDTPDIVSRITQYIAGANC
AHQLPIAEAMLTYKQKSPDEESSQKFIPFVGVVKV
GIVEPSSATSGDSDDAAPSGSGTLSSTPPSASPAA
KEASPTPPSSPSVSGG
Storage
-20C
Provider Type Product Number
- No reagents -