Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405162 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-One Cut Homeobox 1 (ONECUT1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ONECUT1 antibody: synthetic peptide directed towards the middle region of human ONECUT1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSS
NSGNS SSSSSTCTKA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Hepatocyte nuclear factor 6 suppresses the migration and invasive growth of lung cancer cells through p53 and the inhibition of epithelial-mesenchymal transition.
Distribution of the interstitial Cajal-like cells in the gallbladder and extrahepatic biliary duct of the guinea-pig.
Loss of ONECUT1 expression in human pancreatic cancer cells.
Yuan XW, Wang DM, Hu Y, Tang YN, Shi WW, Guo XJ, Song JG
The Journal of biological chemistry 2013 Oct 25;288(43):31206-16
The Journal of biological chemistry 2013 Oct 25;288(43):31206-16
Distribution of the interstitial Cajal-like cells in the gallbladder and extrahepatic biliary duct of the guinea-pig.
Huang Y, Mei F, Yu B, Zhang HJ, Han J, Jiang ZY, Zhou DS
Acta histochemica 2009;111(2):157-65
Acta histochemica 2009;111(2):157-65
Loss of ONECUT1 expression in human pancreatic cancer cells.
Jiang X, Zhang W, Kayed H, Zheng P, Giese NA, Friess H, Kleeff J
Oncology reports 2008 Jan;19(1):157-63
Oncology reports 2008 Jan;19(1):157-63
No comments: Submit comment
No validations: Submit validation data