HPA003457

ONECUT1 antibody from Sigma-Aldrich
HNF-6, HNF6, HNF6A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003457
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003457, RRID:AB_1079525
Product name
Anti-ONECUT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003457
Antibody type
Polyclonal
Antigen
Hepatocyte nuclear factor 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SMNNLYTPYHKDVAGMGQSLSPLSSSGLGSIHNSQ
QGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRH
GEQHLTPTSAGMVPINGLPPHHPHAHLNAQGHGQL
LGTAREPNPSVTGAQVSNGSNSGQMEEINTKEV
Storage
-20C
Provider Type Product Number
- No reagents -