HPA017425

NAALADL2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017425
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017425, RRID:AB_1854275
Product name
Anti-NAALADL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017425
Antibody type
Polyclonal
Antigen
Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQWTSLGLEDVQFVNYSVLLDLPGPSPSTVTLSSS
GQCFHPNGQPCSEEARKDSSQDLLYSYAAYSAKGT
LKAEVIDVSYGMADDLKRIRKIKNVTNQIALLKLG
KLPLLY
Storage
-20C
Provider Type Product Number
- No reagents -