Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011016-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011016-B01P, RRID:AB_1571532
- Product name
- ATF7 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human ATF7 protein.
- Antigen sequence
MGDDRPFVCNAPGCGQRFTNEDHLAVHKHKHEMTL
KFGPARTDSVIIADQTPTPTRFLKNCEEVGLFNEL
ASSFEHEFKKAADEDEKKAAAGPLDMSLPSTPDIK
IKEEEPVEVDSSPPDSPASSPCSPPLKEKEVTPKP
VLISTPTPTIVRPGSLPLHLGYDPLHPTLPSPTSV
ITQAPPSNRQMGSPTGSLPLVMHLANGQTMPVLPG
PPVQMPSVISLARPVSMVPNIPGIPGPPVNSSGSI
SPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVG
TASTMVTARPEQSQILIQHPDAPSPAQPQVSPAQP
TPSTGGRRRRTVDEDPDERRQRFLERNRAAASRCR
QKRKLWVSSLEKKAEELTSQNIQLSNEVTLLRNEV
AQLKQLLLAHKDCPVTALQKKTQGYLESPKESSEP
TGSPAPVIQHSSATAPSNGLSVRSAAEAVATSVLT
QMASQRTELSMPIQSHVIMTPQSQSAGR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ATF7 expression in transfected 293T cell line (H00011016-T01) by ATF7 MaxPab polyclonal antibody.Lane 1: ATF7 transfected lysate(53.13 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ATF7 MaxPab polyclonal antibody. Western Blot analysis of ATF7 expression in Hela S3 NE.