HPA003384

ATF7 antibody from Sigma-Aldrich
ATFA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003384
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003384, RRID:AB_1078234
Product name
Anti-ATF7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003384
Antibody type
Polyclonal
Antigen
Cyclic AMP-dependent transcription factor ATF-7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPGPPVQMPSVISLARPVSMVPNIPGIPGPPVNSS
GSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGM
VVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSP
AQPTPSTGGRRRRTVDEDPDERRQRFLE
Storage
-20C
Provider Type Product Number
- No reagents -