HPA020090

DDX25 antibody from Sigma-Aldrich
GRTH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020090
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020090, RRID:AB_1847551
Product name
Anti-DDX25 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020090
Antibody type
Polyclonal
Antigen
ATP-dependent RNA helicase DDX25 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KQVTIVVNFDLPVKQGEEPDYETYLHRIGRTGRFG
KKGLAFNMIEVDELPSLMKIQDHFNSSIKQLNAED
MDEIE
Storage
-20C
Provider Type Product Number
- No reagents -